Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519
  1. Avatar for Jim Fraser 131. Jim Fraser Lv 1 3 pts. 7,765
  2. Avatar for Mohambone 132. Mohambone Lv 1 3 pts. 7,758
  3. Avatar for SineniF 133. SineniF Lv 1 3 pts. 7,743
  4. Avatar for SouperGenious 134. SouperGenious Lv 1 3 pts. 7,736
  5. Avatar for demeter900 135. demeter900 Lv 1 3 pts. 7,688
  6. Avatar for MurloW 136. MurloW Lv 1 3 pts. 7,678
  7. Avatar for cakesok 137. cakesok Lv 1 3 pts. 7,647
  8. Avatar for cherry39 138. cherry39 Lv 1 2 pts. 7,625
  9. Avatar for Close At Hand 139. Close At Hand Lv 1 2 pts. 7,620
  10. Avatar for pllq 140. pllq Lv 1 2 pts. 7,616

Comments