Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for spvincent 11. spvincent Lv 1 82 pts. 8,995
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 80 pts. 8,995
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 79 pts. 8,990
  4. Avatar for pauldunn 14. pauldunn Lv 1 77 pts. 8,968
  5. Avatar for jermainiac 15. jermainiac Lv 1 76 pts. 8,968
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 74 pts. 8,958
  7. Avatar for Timo van der Laan 17. Timo van der Laan Lv 1 72 pts. 8,954
  8. Avatar for isaksson 18. isaksson Lv 1 71 pts. 8,943
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 69 pts. 8,931
  10. Avatar for crpainter 20. crpainter Lv 1 68 pts. 8,882

Comments