Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for Weenlee 221. Weenlee Lv 1 1 pt. 4,244
  2. Avatar for hapalops 222. hapalops Lv 1 1 pt. 4,181
  3. Avatar for MaartenDesnouck 223. MaartenDesnouck Lv 1 1 pt. 4,137
  4. Avatar for poiuyqwert 224. poiuyqwert Lv 1 1 pt. 4,023
  5. Avatar for SamuelJackson 225. SamuelJackson Lv 1 1 pt. 4,000
  6. Avatar for Rico2 226. Rico2 Lv 1 1 pt. 3,963
  7. Avatar for isantheautumn 227. isantheautumn Lv 1 1 pt. 3,810
  8. Avatar for FarzadBekran 228. FarzadBekran Lv 1 1 pt. 3,801
  9. Avatar for steveB 229. steveB Lv 1 1 pt. 3,779
  10. Avatar for DrTree 230. DrTree Lv 1 1 pt. 3,779

Comments