Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for johnmitch 31. johnmitch Lv 1 53 pts. 8,754
  2. Avatar for nicobul 32. nicobul Lv 1 52 pts. 8,752
  3. Avatar for hansvandenhof 33. hansvandenhof Lv 1 51 pts. 8,717
  4. Avatar for caglar 34. caglar Lv 1 50 pts. 8,716
  5. Avatar for LociOiling 35. LociOiling Lv 1 49 pts. 8,711
  6. Avatar for justjustin 36. justjustin Lv 1 48 pts. 8,707
  7. Avatar for Marvelz 37. Marvelz Lv 1 47 pts. 8,705
  8. Avatar for mimi 38. mimi Lv 1 46 pts. 8,684
  9. Avatar for bendbob 39. bendbob Lv 1 45 pts. 8,684
  10. Avatar for Scopper 40. Scopper Lv 1 43 pts. 8,679

Comments