Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for Mike Cassidy 91. Mike Cassidy Lv 1 9 pts. 8,313
  2. Avatar for bendbob 92. bendbob Lv 1 8 pts. 8,312
  3. Avatar for DodoBird 93. DodoBird Lv 1 8 pts. 8,296
  4. Avatar for justjustin 94. justjustin Lv 1 8 pts. 8,296
  5. Avatar for gurch 95. gurch Lv 1 8 pts. 8,295
  6. Avatar for me357 96. me357 Lv 1 7 pts. 8,279
  7. Avatar for t012 97. t012 Lv 1 7 pts. 8,269
  8. Avatar for rinze 98. rinze Lv 1 7 pts. 8,248
  9. Avatar for hada 99. hada Lv 1 7 pts. 8,246
  10. Avatar for ViJay7019 100. ViJay7019 Lv 1 6 pts. 8,242

Comments