Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 15,173
  2. Avatar for Void Crushers 2. Void Crushers 77 pts. 14,460
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 14,455
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 14,225
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 14,199
  6. Avatar for Go Science 6. Go Science 22 pts. 14,017
  7. Avatar for Contenders 7. Contenders 15 pts. 13,840
  8. Avatar for Deleted group 8. Deleted group pts. 13,363
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 12,756
  10. Avatar for xkcd 10. xkcd 5 pts. 12,201
  1. Avatar for Squirrely 101. Squirrely Lv 1 4 pts. 11,757
  2. Avatar for rinze 102. rinze Lv 1 4 pts. 11,731
  3. Avatar for pmlkjn 103. pmlkjn Lv 1 4 pts. 11,714
  4. Avatar for freethought78 104. freethought78 Lv 1 4 pts. 11,695
  5. Avatar for YeshuaLives 105. YeshuaLives Lv 1 4 pts. 11,692
  6. Avatar for BCAA 106. BCAA Lv 1 3 pts. 11,610
  7. Avatar for momadoc 107. momadoc Lv 1 3 pts. 11,530
  8. Avatar for altejoh 108. altejoh Lv 1 3 pts. 11,524
  9. Avatar for Superphosphate 109. Superphosphate Lv 1 3 pts. 11,523
  10. Avatar for YGK 110. YGK Lv 1 3 pts. 11,470

Comments