Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 15,173
  2. Avatar for Void Crushers 2. Void Crushers 77 pts. 14,460
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 14,455
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 14,225
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 14,199
  6. Avatar for Go Science 6. Go Science 22 pts. 14,017
  7. Avatar for Contenders 7. Contenders 15 pts. 13,840
  8. Avatar for Deleted group 8. Deleted group pts. 13,363
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 12,756
  10. Avatar for xkcd 10. xkcd 5 pts. 12,201

  1. Avatar for ManVsYard 81. ManVsYard Lv 1 9 pts. 12,217
  2. Avatar for fryguy 82. fryguy Lv 1 9 pts. 12,201
  3. Avatar for Glen B 83. Glen B Lv 1 9 pts. 12,199
  4. Avatar for TastyMunchies 84. TastyMunchies Lv 1 8 pts. 12,152
  5. Avatar for isaksson 85. isaksson Lv 1 8 pts. 12,149
  6. Avatar for deLaCeiba 86. deLaCeiba Lv 1 8 pts. 12,113
  7. Avatar for aendgraend 87. aendgraend Lv 1 7 pts. 12,102
  8. Avatar for D001x_ErlandStevens 88. D001x_ErlandStevens Lv 1 7 pts. 12,098
  9. Avatar for manu8170 89. manu8170 Lv 1 7 pts. 12,057
  10. Avatar for kitek314_pl 90. kitek314_pl Lv 1 7 pts. 12,042

Comments