Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545
  1. Avatar for matosfran 41. matosfran Lv 1 32 pts. 8,682
  2. Avatar for johnmitch 42. johnmitch Lv 1 31 pts. 8,672
  3. Avatar for Blipperman 43. Blipperman Lv 1 30 pts. 8,652
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 29 pts. 8,645
  5. Avatar for TastyMunchies 45. TastyMunchies Lv 1 28 pts. 8,644
  6. Avatar for altejoh 46. altejoh Lv 1 27 pts. 8,631
  7. Avatar for jeff101 47. jeff101 Lv 1 26 pts. 8,630
  8. Avatar for jamiexq 48. jamiexq Lv 1 25 pts. 8,624
  9. Avatar for nemo7731 49. nemo7731 Lv 1 24 pts. 8,623
  10. Avatar for isaksson 50. isaksson Lv 1 23 pts. 8,612

Comments