Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545
  1. Avatar for Scopper 31. Scopper Lv 1 43 pts. 8,781
  2. Avatar for Glen B 32. Glen B Lv 1 42 pts. 8,767
  3. Avatar for mimi 33. mimi Lv 1 41 pts. 8,760
  4. Avatar for lynnai 34. lynnai Lv 1 39 pts. 8,759
  5. Avatar for bertro 35. bertro Lv 1 38 pts. 8,754
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 37 pts. 8,749
  7. Avatar for pmdpmd 37. pmdpmd Lv 1 36 pts. 8,741
  8. Avatar for NinjaGreg 38. NinjaGreg Lv 1 35 pts. 8,706
  9. Avatar for smilingone 39. smilingone Lv 1 34 pts. 8,701
  10. Avatar for Satina 40. Satina Lv 1 33 pts. 8,688

Comments