Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for Mark- 21. Mark- Lv 1 58 pts. 9,734
  2. Avatar for stomjoh 22. stomjoh Lv 1 57 pts. 9,728
  3. Avatar for Deleted player 23. Deleted player pts. 9,725
  4. Avatar for tarimo 24. tarimo Lv 1 53 pts. 9,711
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 52 pts. 9,697
  6. Avatar for tokens 26. tokens Lv 1 50 pts. 9,693
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 49 pts. 9,690
  8. Avatar for johnmitch 28. johnmitch Lv 1 47 pts. 9,684
  9. Avatar for isaksson 29. isaksson Lv 1 46 pts. 9,682
  10. Avatar for Blipperman 30. Blipperman Lv 1 45 pts. 9,682

Comments