Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,909
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,871
  3. Avatar for Contenders 3. Contenders 52 pts. 9,830
  4. Avatar for Go Science 4. Go Science 36 pts. 9,826
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,803
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,783
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,771
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,567
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 4 pts. 9,533
  10. Avatar for Deleted group 10. Deleted group pts. 9,286

  1. Avatar for Mark- 21. Mark- Lv 1 58 pts. 9,734
  2. Avatar for stomjoh 22. stomjoh Lv 1 57 pts. 9,728
  3. Avatar for Deleted player 23. Deleted player pts. 9,725
  4. Avatar for tarimo 24. tarimo Lv 1 53 pts. 9,711
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 52 pts. 9,697
  6. Avatar for tokens 26. tokens Lv 1 50 pts. 9,693
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 49 pts. 9,690
  8. Avatar for johnmitch 28. johnmitch Lv 1 47 pts. 9,684
  9. Avatar for isaksson 29. isaksson Lv 1 46 pts. 9,682
  10. Avatar for Blipperman 30. Blipperman Lv 1 45 pts. 9,682

Comments