Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400

  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 32 pts. 9,617
  2. Avatar for g_b 42. g_b Lv 1 31 pts. 9,616
  3. Avatar for pvc78 43. pvc78 Lv 1 30 pts. 9,611
  4. Avatar for ZeroLeak7 44. ZeroLeak7 Lv 1 29 pts. 9,606
  5. Avatar for ecali 45. ecali Lv 1 28 pts. 9,601
  6. Avatar for jobo0502 46. jobo0502 Lv 1 27 pts. 9,596
  7. Avatar for Crossed Sticks 47. Crossed Sticks Lv 1 26 pts. 9,593
  8. Avatar for mimi 48. mimi Lv 1 25 pts. 9,591
  9. Avatar for pmthomson90 49. pmthomson90 Lv 1 24 pts. 9,567
  10. Avatar for diamonddays 50. diamonddays Lv 1 23 pts. 9,565

Comments