Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,909
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,871
  3. Avatar for Contenders 3. Contenders 52 pts. 9,830
  4. Avatar for Go Science 4. Go Science 36 pts. 9,826
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,803
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,783
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,771
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,567
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 4 pts. 9,533
  10. Avatar for Deleted group 10. Deleted group pts. 9,286

  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 32 pts. 9,617
  2. Avatar for g_b 42. g_b Lv 1 31 pts. 9,616
  3. Avatar for pvc78 43. pvc78 Lv 1 30 pts. 9,611
  4. Avatar for ZeroLeak7 44. ZeroLeak7 Lv 1 29 pts. 9,606
  5. Avatar for ecali 45. ecali Lv 1 28 pts. 9,601
  6. Avatar for jobo0502 46. jobo0502 Lv 1 27 pts. 9,596
  7. Avatar for Crossed Sticks 47. Crossed Sticks Lv 1 26 pts. 9,593
  8. Avatar for mimi 48. mimi Lv 1 25 pts. 9,591
  9. Avatar for pmthomson90 49. pmthomson90 Lv 1 24 pts. 9,567
  10. Avatar for diamonddays 50. diamonddays Lv 1 23 pts. 9,565

Comments