Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for Graham MF 51. Graham MF Lv 1 23 pts. 9,564
  2. Avatar for crpainter 52. crpainter Lv 1 22 pts. 9,561
  3. Avatar for jamiexq 53. jamiexq Lv 1 21 pts. 9,544
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 20 pts. 9,544
  5. Avatar for Ashrai 55. Ashrai Lv 1 20 pts. 9,535
  6. Avatar for D001x_ErlandStevens 56. D001x_ErlandStevens Lv 1 19 pts. 9,533
  7. Avatar for caglar 57. caglar Lv 1 18 pts. 9,509
  8. Avatar for gurch 58. gurch Lv 1 18 pts. 9,484
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 17 pts. 9,479
  10. Avatar for SKSbell 60. SKSbell Lv 1 16 pts. 9,477

Comments