Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,909
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,871
  3. Avatar for Contenders 3. Contenders 52 pts. 9,830
  4. Avatar for Go Science 4. Go Science 36 pts. 9,826
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,803
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,783
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,771
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,567
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 4 pts. 9,533
  10. Avatar for Deleted group 10. Deleted group pts. 9,286
  1. Avatar for Graham MF 51. Graham MF Lv 1 23 pts. 9,564
  2. Avatar for crpainter 52. crpainter Lv 1 22 pts. 9,561
  3. Avatar for jamiexq 53. jamiexq Lv 1 21 pts. 9,544
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 20 pts. 9,544
  5. Avatar for Ashrai 55. Ashrai Lv 1 20 pts. 9,535
  6. Avatar for D001x_ErlandStevens 56. D001x_ErlandStevens Lv 1 19 pts. 9,533
  7. Avatar for caglar 57. caglar Lv 1 18 pts. 9,509
  8. Avatar for gurch 58. gurch Lv 1 18 pts. 9,484
  9. Avatar for YeshuaLives 59. YeshuaLives Lv 1 17 pts. 9,479
  10. Avatar for SKSbell 60. SKSbell Lv 1 16 pts. 9,477

Comments