Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,006
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,003
  3. Avatar for Deleted group 13. Deleted group pts. 7,870
  4. Avatar for Advanced Protein Science 2 - 2016 14. Advanced Protein Science 2 - 2016 1 pt. 7,426
  5. Avatar for freefolder 15. freefolder 1 pt. 7,247
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,810
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 4,813
  1. Avatar for andrewxc 81. andrewxc Lv 1 7 pts. 8,475
  2. Avatar for Mike Lewis 82. Mike Lewis Lv 1 6 pts. 8,467
  3. Avatar for SKSbell 83. SKSbell Lv 1 6 pts. 8,457
  4. Avatar for alwen 84. alwen Lv 1 6 pts. 8,452
  5. Avatar for froggs554 85. froggs554 Lv 1 6 pts. 8,421
  6. Avatar for altejoh 86. altejoh Lv 1 5 pts. 8,410
  7. Avatar for uihcv 87. uihcv Lv 1 5 pts. 8,391
  8. Avatar for ecali 88. ecali Lv 1 5 pts. 8,366
  9. Avatar for guineapig 89. guineapig Lv 1 5 pts. 8,364
  10. Avatar for The_Lunar_1 90. The_Lunar_1 Lv 1 4 pts. 8,358

Comments