Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,540
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 9,512
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,487
  4. Avatar for Go Science 4. Go Science 36 pts. 9,411
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,314
  6. Avatar for Contenders 6. Contenders 16 pts. 9,305
  7. Avatar for D001x Med Chem MOOC 7. D001x Med Chem MOOC 10 pts. 9,089
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 9,078
  9. Avatar for Deleted group 9. Deleted group pts. 8,775
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,312
  1. Avatar for andrewxc 81. andrewxc Lv 1 7 pts. 8,475
  2. Avatar for Mike Lewis 82. Mike Lewis Lv 1 6 pts. 8,467
  3. Avatar for SKSbell 83. SKSbell Lv 1 6 pts. 8,457
  4. Avatar for alwen 84. alwen Lv 1 6 pts. 8,452
  5. Avatar for froggs554 85. froggs554 Lv 1 6 pts. 8,421
  6. Avatar for altejoh 86. altejoh Lv 1 5 pts. 8,410
  7. Avatar for uihcv 87. uihcv Lv 1 5 pts. 8,391
  8. Avatar for ecali 88. ecali Lv 1 5 pts. 8,366
  9. Avatar for guineapig 89. guineapig Lv 1 5 pts. 8,364
  10. Avatar for The_Lunar_1 90. The_Lunar_1 Lv 1 4 pts. 8,358

Comments