Foldit

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created: June 13, 2016
Expires: June 20, 2016 at 23:00 UTC
Max points: 100

Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.

Sequence:

ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

1. Beta Folders
100 pts. 9,540
2. Void Crushers 73 pts. 9,512
3. Anthropic Dreams 52 pts. 9,487
4. Go Science 36 pts. 9,411
5. L'Alliance Francophone 24 pts. 9,314
6. Contenders 16 pts. 9,305
7. D001x Med Chem MOOC 10 pts. 9,089
8. Gargleblasters 6 pts. 9,078
9. Deleted group pts. 8,775
10. Italiani Al Lavoro 2 pts. 8,312

111. brolly Lv 1 2 pts. 8,118
112. Squirrely Lv 1 2 pts. 8,092
113. lynnai Lv 1 2 pts. 8,085
114. cnhrcolemam Lv 1 1 pt. 8,023
115. kitek314_pl Lv 1 1 pt. 8,006
116. BCAA Lv 1 1 pt. 8,003
117. NotJim99 Lv 1 1 pt. 7,985
118. Aikuiba Lv 1 1 pt. 7,967
119. ivory333 Lv 1 1 pt. 7,964
120. leomisso Lv 1 1 pt. 7,940

Comments

jeff101 Lv 1

June 14, 2016

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.