Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for Galaxie 11. Galaxie Lv 1 78 pts. 9,804
  2. Avatar for frood66 12. frood66 Lv 1 76 pts. 9,802
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 74 pts. 9,799
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 72 pts. 9,797
  5. Avatar for Deleted player 15. Deleted player pts. 9,774
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 68 pts. 9,774
  7. Avatar for actiasluna 17. actiasluna Lv 1 67 pts. 9,745
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 65 pts. 9,738
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 63 pts. 9,709
  10. Avatar for Blipperman 20. Blipperman Lv 1 61 pts. 9,709

Comments