Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 39 pts. 8,808
  2. Avatar for mimi 32. mimi Lv 1 37 pts. 8,796
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 36 pts. 8,782
  4. Avatar for reefyrob 34. reefyrob Lv 1 35 pts. 8,776
  5. Avatar for gcm24 35. gcm24 Lv 1 34 pts. 8,773
  6. Avatar for Origami314 36. Origami314 Lv 1 32 pts. 8,768
  7. Avatar for Glen B 37. Glen B Lv 1 31 pts. 8,765
  8. Avatar for Mike Lewis 38. Mike Lewis Lv 1 30 pts. 8,762
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 29 pts. 8,756
  10. Avatar for weitzen 40. weitzen Lv 1 28 pts. 8,755

Comments