Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for boondog 71. boondog Lv 1 8 pts. 8,566
  2. Avatar for YGK 72. YGK Lv 1 7 pts. 8,560
  3. Avatar for jamiexq 73. jamiexq Lv 1 7 pts. 8,557
  4. Avatar for jobo0502 74. jobo0502 Lv 1 7 pts. 8,550
  5. Avatar for dbuske 75. dbuske Lv 1 6 pts. 8,548
  6. Avatar for g_b 76. g_b Lv 1 6 pts. 8,524
  7. Avatar for tallguy-13088 77. tallguy-13088 Lv 1 6 pts. 8,519
  8. Avatar for caglar 78. caglar Lv 1 6 pts. 8,517
  9. Avatar for altejoh 79. altejoh Lv 1 5 pts. 8,506
  10. Avatar for diamonddays 80. diamonddays Lv 1 5 pts. 8,505

Comments