Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for Pietro MSB 111. Pietro MSB Lv 1 1 pt. 9,212
  2. Avatar for rezaefar 112. rezaefar Lv 1 1 pt. 9,208
  3. Avatar for IlPero 113. IlPero Lv 1 1 pt. 9,181
  4. Avatar for Wheeler22 114. Wheeler22 Lv 1 1 pt. 9,169
  5. Avatar for NotJim99 115. NotJim99 Lv 1 1 pt. 9,163
  6. Avatar for ecali 116. ecali Lv 1 1 pt. 9,153
  7. Avatar for froggs554 117. froggs554 Lv 1 1 pt. 9,153
  8. Avatar for HMK 118. HMK Lv 1 1 pt. 9,152
  9. Avatar for ivalnic 119. ivalnic Lv 1 1 pt. 9,145
  10. Avatar for pfirth 120. pfirth Lv 1 1 pt. 9,142

Comments