Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for martinf 121. martinf Lv 1 1 pt. 9,134
  2. Avatar for benjimoos 122. benjimoos Lv 1 1 pt. 9,124
  3. Avatar for dahast.de 123. dahast.de Lv 1 1 pt. 9,109
  4. Avatar for lamoille 124. lamoille Lv 1 1 pt. 9,106
  5. Avatar for aspadistra 125. aspadistra Lv 1 1 pt. 9,105
  6. Avatar for Punktchen 126. Punktchen Lv 1 1 pt. 9,102
  7. Avatar for Cerzax 127. Cerzax Lv 1 1 pt. 9,058
  8. Avatar for roman madala 128. roman madala Lv 1 1 pt. 9,036
  9. Avatar for mitarcher 129. mitarcher Lv 1 1 pt. 9,005
  10. Avatar for boondog 130. boondog Lv 1 1 pt. 8,999

Comments