Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for inkycatz 141. inkycatz Lv 1 1 pt. 7,834
  2. Avatar for pasiasta_zebra 142. pasiasta_zebra Lv 1 1 pt. 7,690
  3. Avatar for naturacy 143. naturacy Lv 1 1 pt. 7,468
  4. Avatar for Museka 144. Museka Lv 1 1 pt. 7,338
  5. Avatar for KUKUDI 145. KUKUDI Lv 1 1 pt. 7,166
  6. Avatar for Jeanie Seo 146. Jeanie Seo Lv 1 1 pt. 5,704
  7. Avatar for Susume 147. Susume Lv 1 1 pt. 5,567
  8. Avatar for martin.szew 148. martin.szew Lv 1 1 pt. 5,567
  9. Avatar for Prometheus1992 149. Prometheus1992 Lv 1 1 pt. 5,567
  10. Avatar for Hollinas 150. Hollinas Lv 1 1 pt. 5,567

Comments