Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for alwen 31. alwen Lv 1 33 pts. 9,916
  2. Avatar for Bletchley Park 32. Bletchley Park Lv 1 32 pts. 9,915
  3. Avatar for Steven Pletsch 33. Steven Pletsch Lv 1 30 pts. 9,913
  4. Avatar for gmn 34. gmn Lv 1 29 pts. 9,910
  5. Avatar for Scopper 35. Scopper Lv 1 28 pts. 9,908
  6. Avatar for pvc78 36. pvc78 Lv 1 27 pts. 9,908
  7. Avatar for kabubi 37. kabubi Lv 1 26 pts. 9,905
  8. Avatar for Ashrai 38. Ashrai Lv 1 24 pts. 9,892
  9. Avatar for jdormaar 39. jdormaar Lv 1 23 pts. 9,890
  10. Avatar for Blipperman 40. Blipperman Lv 1 22 pts. 9,890

Comments