Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553

  1. Avatar for K4rlos 161. K4rlos Lv 1 1 pt. 5,648
  2. Avatar for meatexplosion 162. meatexplosion Lv 1 1 pt. 5,639
  3. Avatar for guezzy 163. guezzy Lv 1 1 pt. 5,563
  4. Avatar for Tlaloc 164. Tlaloc Lv 1 1 pt. 5,553
  5. Avatar for krudolph 165. krudolph Lv 1 1 pt. 5,540
  6. Avatar for Cerzax 166. Cerzax Lv 1 1 pt. 5,514
  7. Avatar for Nusayr 167. Nusayr Lv 1 1 pt. 5,513
  8. Avatar for GoodGuyGreg 168. GoodGuyGreg Lv 1 1 pt. 5,502
  9. Avatar for Anamfija 169. Anamfija Lv 1 1 pt. 5,500
  10. Avatar for Thesilverlight 170. Thesilverlight Lv 1 1 pt. 5,497

Comments