Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for pmthomson90 21. pmthomson90 Lv 1 60 pts. 9,508
  2. Avatar for phi16 22. phi16 Lv 1 59 pts. 9,503
  3. Avatar for eromana 23. eromana Lv 1 57 pts. 9,499
  4. Avatar for Fetztastic 24. Fetztastic Lv 1 56 pts. 9,498
  5. Avatar for gcm24 25. gcm24 Lv 1 54 pts. 9,496
  6. Avatar for pauldunn 26. pauldunn Lv 1 53 pts. 9,494
  7. Avatar for tokens 27. tokens Lv 1 51 pts. 9,489
  8. Avatar for gmn 28. gmn Lv 1 50 pts. 9,467
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 48 pts. 9,465
  10. Avatar for johnmitch 30. johnmitch Lv 1 47 pts. 9,458

Comments