Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,647
  2. Avatar for Go Science 2. Go Science 74 pts. 9,631
  3. Avatar for Contenders 3. Contenders 54 pts. 9,623
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,619
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,603
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,582
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 9,508
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,432
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,377
  10. Avatar for Deleted group 10. Deleted group pts. 9,222

  1. Avatar for pmthomson90 21. pmthomson90 Lv 1 60 pts. 9,508
  2. Avatar for phi16 22. phi16 Lv 1 59 pts. 9,503
  3. Avatar for eromana 23. eromana Lv 1 57 pts. 9,499
  4. Avatar for Fetztastic 24. Fetztastic Lv 1 56 pts. 9,498
  5. Avatar for gcm24 25. gcm24 Lv 1 54 pts. 9,496
  6. Avatar for pauldunn 26. pauldunn Lv 1 53 pts. 9,494
  7. Avatar for tokens 27. tokens Lv 1 51 pts. 9,489
  8. Avatar for gmn 28. gmn Lv 1 50 pts. 9,467
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 48 pts. 9,465
  10. Avatar for johnmitch 30. johnmitch Lv 1 47 pts. 9,458

Comments