Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for crpainter 41. crpainter Lv 1 34 pts. 9,368
  2. Avatar for cobaltteal 42. cobaltteal Lv 1 33 pts. 9,362
  3. Avatar for g_b 43. g_b Lv 1 32 pts. 9,358
  4. Avatar for kabubi 44. kabubi Lv 1 31 pts. 9,351
  5. Avatar for Skippysk8s 45. Skippysk8s Lv 1 30 pts. 9,349
  6. Avatar for retiredmichael 46. retiredmichael Lv 1 29 pts. 9,346
  7. Avatar for TomTaylor 47. TomTaylor Lv 1 29 pts. 9,336
  8. Avatar for Glen B 48. Glen B Lv 1 28 pts. 9,328
  9. Avatar for smilingone 49. smilingone Lv 1 27 pts. 9,323
  10. Avatar for Deleted player 50. Deleted player pts. 9,323

Comments