Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,647
  2. Avatar for Go Science 2. Go Science 74 pts. 9,631
  3. Avatar for Contenders 3. Contenders 54 pts. 9,623
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,619
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,603
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,582
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 9,508
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,432
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,377
  10. Avatar for Deleted group 10. Deleted group pts. 9,222
  1. Avatar for crpainter 41. crpainter Lv 1 34 pts. 9,368
  2. Avatar for cobaltteal 42. cobaltteal Lv 1 33 pts. 9,362
  3. Avatar for g_b 43. g_b Lv 1 32 pts. 9,358
  4. Avatar for kabubi 44. kabubi Lv 1 31 pts. 9,351
  5. Avatar for Skippysk8s 45. Skippysk8s Lv 1 30 pts. 9,349
  6. Avatar for retiredmichael 46. retiredmichael Lv 1 29 pts. 9,346
  7. Avatar for TomTaylor 47. TomTaylor Lv 1 29 pts. 9,336
  8. Avatar for Glen B 48. Glen B Lv 1 28 pts. 9,328
  9. Avatar for smilingone 49. smilingone Lv 1 27 pts. 9,323
  10. Avatar for Deleted player 50. Deleted player pts. 9,323

Comments