Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,146
  2. Avatar for xkcd 12. xkcd 1 pt. 9,023
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,948
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,815
  5. Avatar for freefolder 15. freefolder 1 pt. 8,751
  6. Avatar for Androids 16. Androids 1 pt. 8,349
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 6,811
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 5,553
  1. Avatar for pfirth 81. pfirth Lv 1 9 pts. 9,165
  2. Avatar for Vincenzo Brancaccio 82. Vincenzo Brancaccio Lv 1 9 pts. 9,160
  3. Avatar for ComputerMage 83. ComputerMage Lv 1 8 pts. 9,146
  4. Avatar for mitarcher 84. mitarcher Lv 1 8 pts. 9,141
  5. Avatar for Ashrai 85. Ashrai Lv 1 8 pts. 9,137
  6. Avatar for manu8170 86. manu8170 Lv 1 7 pts. 9,127
  7. Avatar for poiuyqwert 87. poiuyqwert Lv 1 7 pts. 9,127
  8. Avatar for SouperGenious 88. SouperGenious Lv 1 7 pts. 9,109
  9. Avatar for jamiexq 89. jamiexq Lv 1 7 pts. 9,108
  10. Avatar for Deleted player 90. Deleted player 6 pts. 9,102

Comments