Placeholder image of a protein
Icon representing a puzzle

1264: Revisiting Puzzle 63: Spinach Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,647
  2. Avatar for Go Science 2. Go Science 74 pts. 9,631
  3. Avatar for Contenders 3. Contenders 54 pts. 9,623
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 9,619
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,603
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,582
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 12 pts. 9,508
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,432
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,377
  10. Avatar for Deleted group 10. Deleted group pts. 9,222

  1. Avatar for pfirth 81. pfirth Lv 1 9 pts. 9,165
  2. Avatar for ComputerMage 83. ComputerMage Lv 1 8 pts. 9,146
  3. Avatar for mitarcher 84. mitarcher Lv 1 8 pts. 9,141
  4. Avatar for Ashrai 85. Ashrai Lv 1 8 pts. 9,137
  5. Avatar for manu8170 86. manu8170 Lv 1 7 pts. 9,127
  6. Avatar for poiuyqwert 87. poiuyqwert Lv 1 7 pts. 9,127
  7. Avatar for SouperGenious 88. SouperGenious Lv 1 7 pts. 9,109
  8. Avatar for jamiexq 89. jamiexq Lv 1 7 pts. 9,108
  9. Avatar for Deleted player 90. Deleted player 6 pts. 9,102

Comments