Placeholder image of a protein
Icon representing a puzzle

1267: Revisiting Puzzle 64: Thioredoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 1 pt. 9,885
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,791
  3. Avatar for xkcd 13. xkcd 1 pt. 9,717
  4. Avatar for freefolder 14. freefolder 1 pt. 9,659
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 9,492
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 9,456
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,410

  1. Avatar for pmdpmd 31. pmdpmd Lv 1 43 pts. 9,931
  2. Avatar for hpaege 32. hpaege Lv 1 42 pts. 9,930
  3. Avatar for Steven Pletsch 33. Steven Pletsch Lv 1 40 pts. 9,929
  4. Avatar for smilingone 34. smilingone Lv 1 39 pts. 9,927
  5. Avatar for tallguy-13088 35. tallguy-13088 Lv 1 38 pts. 9,925
  6. Avatar for pvc78 36. pvc78 Lv 1 37 pts. 9,925
  7. Avatar for Blipperman 37. Blipperman Lv 1 36 pts. 9,922
  8. Avatar for Museka 38. Museka Lv 1 35 pts. 9,921
  9. Avatar for jobo0502 39. jobo0502 Lv 1 33 pts. 9,919
  10. Avatar for joremen 40. joremen Lv 1 32 pts. 9,918

Comments