Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469

  1. Avatar for No_Idea 101. No_Idea Lv 1 2 pts. 8,920
  2. Avatar for Amphimixus 102. Amphimixus Lv 1 2 pts. 8,915
  3. Avatar for TastyMunchies 103. TastyMunchies Lv 1 2 pts. 8,915
  4. Avatar for SouperGenious 104. SouperGenious Lv 1 2 pts. 8,915
  5. Avatar for uihcv 105. uihcv Lv 1 2 pts. 8,914
  6. Avatar for hansvandenhof 106. hansvandenhof Lv 1 2 pts. 8,914
  7. Avatar for fryguy 107. fryguy Lv 1 1 pt. 8,909
  8. Avatar for Arne Heessels 108. Arne Heessels Lv 1 1 pt. 8,909
  9. Avatar for alwen 110. alwen Lv 1 1 pt. 8,901

Comments