Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469

  1. Avatar for Wheeler22 111. Wheeler22 Lv 1 1 pt. 8,893
  2. Avatar for ecali 112. ecali Lv 1 1 pt. 8,892
  3. Avatar for actin19 113. actin19 Lv 1 1 pt. 8,887
  4. Avatar for dbuske 114. dbuske Lv 1 1 pt. 8,887
  5. Avatar for rinze 115. rinze Lv 1 1 pt. 8,886
  6. Avatar for leehaggis 116. leehaggis Lv 1 1 pt. 8,882
  7. Avatar for Iron pet 117. Iron pet Lv 1 1 pt. 8,876
  8. Avatar for NinjaGreg 118. NinjaGreg Lv 1 1 pt. 8,865
  9. Avatar for martinf 119. martinf Lv 1 1 pt. 8,859
  10. Avatar for ManVsYard 120. ManVsYard Lv 1 1 pt. 8,859

Comments