Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469

  1. Avatar for pemmer77 141. pemmer77 Lv 1 1 pt. 8,711
  2. Avatar for bergie72 142. bergie72 Lv 1 1 pt. 8,701
  3. Avatar for parsnip 143. parsnip Lv 1 1 pt. 8,700
  4. Avatar for Je Maintiendrai 144. Je Maintiendrai Lv 1 1 pt. 8,687
  5. Avatar for momadoc 145. momadoc Lv 1 1 pt. 8,687
  6. Avatar for jeacom 146. jeacom Lv 1 1 pt. 8,674
  7. Avatar for ErazorOne 147. ErazorOne Lv 1 1 pt. 8,661
  8. Avatar for franse 148. franse Lv 1 1 pt. 8,660
  9. Avatar for jackscomplex 149. jackscomplex Lv 1 1 pt. 8,660
  10. Avatar for Ilya Petrovich 150. Ilya Petrovich Lv 1 1 pt. 8,656

Comments