Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469
  1. Avatar for emdee314 171. emdee314 Lv 1 1 pt. 8,350
  2. Avatar for jarrodahenbest 172. jarrodahenbest Lv 1 1 pt. 8,274
  3. Avatar for 01010011111 173. 01010011111 Lv 1 1 pt. 7,982
  4. Avatar for MFVGML 174. MFVGML Lv 1 1 pt. 7,575
  5. Avatar for naturacy 175. naturacy Lv 1 1 pt. 7,494
  6. Avatar for matosfran 176. matosfran Lv 1 1 pt. 7,494
  7. Avatar for gdnskye 177. gdnskye Lv 1 1 pt. 7,494

Comments