Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469

  1. Avatar for frood66 11. frood66 Lv 1 75 pts. 9,172
  2. Avatar for gitwut 12. gitwut Lv 1 73 pts. 9,167
  3. Avatar for joremen 13. joremen Lv 1 71 pts. 9,165
  4. Avatar for Galaxie 14. Galaxie Lv 1 69 pts. 9,164
  5. Avatar for Deleted player 15. Deleted player pts. 9,164
  6. Avatar for tomespen 16. tomespen Lv 1 65 pts. 9,164
  7. Avatar for Pagdzin 17. Pagdzin Lv 1 63 pts. 9,163
  8. Avatar for g_b 18. g_b Lv 1 61 pts. 9,162
  9. Avatar for Deleted player 19. Deleted player 59 pts. 9,162
  10. Avatar for dembones 20. dembones Lv 1 57 pts. 9,162

Comments