Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469
  1. Avatar for eromana 51. eromana Lv 1 19 pts. 9,108
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 19 pts. 9,108
  3. Avatar for christioanchauvin 53. christioanchauvin Lv 1 18 pts. 9,108
  4. Avatar for YeshuaLives 54. YeshuaLives Lv 1 17 pts. 9,107
  5. Avatar for smholst 55. smholst Lv 1 17 pts. 9,106
  6. Avatar for Mark- 56. Mark- Lv 1 16 pts. 9,105
  7. Avatar for jamiexq 57. jamiexq Lv 1 15 pts. 9,104
  8. Avatar for Steven Pletsch 58. Steven Pletsch Lv 1 15 pts. 9,102
  9. Avatar for TomTaylor 59. TomTaylor Lv 1 14 pts. 9,101
  10. Avatar for weitzen 60. weitzen Lv 1 13 pts. 9,100

Comments