Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469

  1. Avatar for georg137 61. georg137 Lv 1 13 pts. 9,095
  2. Avatar for carsonfb 62. carsonfb Lv 1 12 pts. 9,093
  3. Avatar for jobo0502 63. jobo0502 Lv 1 12 pts. 9,085
  4. Avatar for phi16 64. phi16 Lv 1 11 pts. 9,078
  5. Avatar for guineapig 65. guineapig Lv 1 11 pts. 9,075
  6. Avatar for sheerbliss 66. sheerbliss Lv 1 10 pts. 9,065
  7. Avatar for ViJay7019 67. ViJay7019 Lv 1 10 pts. 9,061
  8. Avatar for diamonddays 68. diamonddays Lv 1 10 pts. 9,057
  9. Avatar for caglar 69. caglar Lv 1 9 pts. 9,056
  10. Avatar for MicElephant 70. MicElephant Lv 1 9 pts. 9,054

Comments