Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469
  1. Avatar for froggs554 81. froggs554 Lv 1 5 pts. 8,993
  2. Avatar for pandapharmd 82. pandapharmd Lv 1 5 pts. 8,993
  3. Avatar for Simek 83. Simek Lv 1 5 pts. 8,993
  4. Avatar for Deleted player 84. Deleted player pts. 8,992
  5. Avatar for andrewxc 85. andrewxc Lv 1 4 pts. 8,990
  6. Avatar for stomjoh 86. stomjoh Lv 1 4 pts. 8,989
  7. Avatar for cherry39 87. cherry39 Lv 1 4 pts. 8,984
  8. Avatar for jermainiac 88. jermainiac Lv 1 4 pts. 8,981
  9. Avatar for Glen B 89. Glen B Lv 1 4 pts. 8,979
  10. Avatar for roman madala 90. roman madala Lv 1 3 pts. 8,977

Comments