Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,213
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,197
  3. Avatar for Go Science 3. Go Science 44 pts. 9,185
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,179
  5. Avatar for Contenders 5. Contenders 16 pts. 9,167
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,159
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,158
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,126
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,102
  1. Avatar for nicobul 21. nicobul Lv 1 55 pts. 9,159
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 53 pts. 9,158
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 52 pts. 9,158
  4. Avatar for Mike Lewis 24. Mike Lewis Lv 1 50 pts. 9,157
  5. Avatar for Aubade01 25. Aubade01 Lv 1 49 pts. 9,156
  6. Avatar for mimi 26. mimi Lv 1 47 pts. 9,154
  7. Avatar for actiasluna 27. actiasluna Lv 1 45 pts. 9,149
  8. Avatar for Bletchley Park 28. Bletchley Park Lv 1 44 pts. 9,149
  9. Avatar for pvc78 29. pvc78 Lv 1 43 pts. 9,146
  10. Avatar for tokens 30. tokens Lv 1 41 pts. 9,145

Comments