1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Summary

• Created: August 10, 2016
• Expires: August 17, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

• 1. Beta Folders 100 pts. 9,213
• 2. Anthropic Dreams 68 pts. 9,197
• 3. Go Science 44 pts. 9,185
• 4. Gargleblasters 27 pts. 9,179
• 5. Contenders 16 pts. 9,167
• 6. L'Alliance Francophone 9 pts. 9,159
• 7. Void Crushers 5 pts. 9,158
• 8. HMT heritage 3 pts. 9,126
• 9. Italiani Al Lavoro 1 pt. 9,120
• 10. Deleted group pts. 9,102

Top soloists

• 31. tallguy-13088 40 pts. 9,144
• 32. Museka 38 pts. 9,143
• 33. Norrjane 37 pts. 9,141
• 34. Marvelz 36 pts. 9,137
• 35. fiendish_ghoul 35 pts. 9,133
• 36. Satina 34 pts. 9,131
• 37. kabubi 32 pts. 9,128
• 38. Vredeman 31 pts. 9,127
• 39. aznarog 30 pts. 9,127
• 40. pmdpmd 29 pts. 9,127