Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for DScott 131. DScott Lv 1 1 pt. 8,475
  2. Avatar for Pietro MSB 132. Pietro MSB Lv 1 1 pt. 8,468
  3. Avatar for AEJensen 133. AEJensen Lv 1 1 pt. 8,455
  4. Avatar for Dantoto 134. Dantoto Lv 1 1 pt. 8,451
  5. Avatar for Hollinas 135. Hollinas Lv 1 1 pt. 8,437
  6. Avatar for alrianne 136. alrianne Lv 1 1 pt. 8,425
  7. Avatar for richard c 137. richard c Lv 1 1 pt. 8,383
  8. Avatar for JackONeill12 138. JackONeill12 Lv 1 1 pt. 8,383
  9. Avatar for t0903591 139. t0903591 Lv 1 1 pt. 8,307
  10. Avatar for wjy1 140. wjy1 Lv 1 1 pt. 8,295

Comments