Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910
  1. Avatar for DScott 131. DScott Lv 1 1 pt. 8,475
  2. Avatar for Pietro MSB 132. Pietro MSB Lv 1 1 pt. 8,468
  3. Avatar for AEJensen 133. AEJensen Lv 1 1 pt. 8,455
  4. Avatar for Dantoto 134. Dantoto Lv 1 1 pt. 8,451
  5. Avatar for Hollinas 135. Hollinas Lv 1 1 pt. 8,437
  6. Avatar for alrianne 136. alrianne Lv 1 1 pt. 8,425
  7. Avatar for richard c 137. richard c Lv 1 1 pt. 8,383
  8. Avatar for JackONeill12 138. JackONeill12 Lv 1 1 pt. 8,383
  9. Avatar for t0903591 139. t0903591 Lv 1 1 pt. 8,307
  10. Avatar for wjy1 140. wjy1 Lv 1 1 pt. 8,295

Comments