Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for jeacom 141. jeacom Lv 1 1 pt. 8,288
  2. Avatar for momadoc 142. momadoc Lv 1 1 pt. 8,277
  3. Avatar for aspadistra 143. aspadistra Lv 1 1 pt. 8,274
  4. Avatar for xplocast1 144. xplocast1 Lv 1 1 pt. 8,268
  5. Avatar for lockert 145. lockert Lv 1 1 pt. 8,253
  6. Avatar for HMK 146. HMK Lv 1 1 pt. 8,230
  7. Avatar for Jimmy Oh 147. Jimmy Oh Lv 1 1 pt. 8,215
  8. Avatar for Kherann 148. Kherann Lv 1 1 pt. 8,183
  9. Avatar for AxelHawke 149. AxelHawke Lv 1 1 pt. 8,181
  10. Avatar for Adri1-P 150. Adri1-P Lv 1 1 pt. 8,171

Comments