Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910

  1. Avatar for jeacom 141. jeacom Lv 1 1 pt. 8,288
  2. Avatar for momadoc 142. momadoc Lv 1 1 pt. 8,277
  3. Avatar for aspadistra 143. aspadistra Lv 1 1 pt. 8,274
  4. Avatar for xplocast1 144. xplocast1 Lv 1 1 pt. 8,268
  5. Avatar for lockert 145. lockert Lv 1 1 pt. 8,253
  6. Avatar for HMK 146. HMK Lv 1 1 pt. 8,230
  7. Avatar for Jimmy Oh 147. Jimmy Oh Lv 1 1 pt. 8,215
  8. Avatar for Kherann 148. Kherann Lv 1 1 pt. 8,183
  9. Avatar for AxelHawke 149. AxelHawke Lv 1 1 pt. 8,181
  10. Avatar for Adri1-P 150. Adri1-P Lv 1 1 pt. 8,171

Comments