Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for Ahmed Moh. appas 151. Ahmed Moh. appas Lv 1 1 pt. 8,089
  2. Avatar for Jaco van As 152. Jaco van As Lv 1 1 pt. 8,023
  3. Avatar for ItzMrCuddles 153. ItzMrCuddles Lv 1 1 pt. 7,948
  4. Avatar for bendbob 154. bendbob Lv 1 1 pt. 7,827
  5. Avatar for mirjamvandelft 155. mirjamvandelft Lv 1 1 pt. 7,584
  6. Avatar for MaxSaddow 156. MaxSaddow Lv 1 1 pt. 7,402
  7. Avatar for Tac1 157. Tac1 Lv 1 1 pt. 7,160
  8. Avatar for 01010011111 158. 01010011111 Lv 1 1 pt. 6,516
  9. Avatar for attylass 159. attylass Lv 1 1 pt. 5,419
  10. Avatar for KingKnut 160. KingKnut Lv 1 1 pt. 5,382

Comments