Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910

  1. Avatar for Ahmed Moh. appas 151. Ahmed Moh. appas Lv 1 1 pt. 8,089
  2. Avatar for Jaco van As 152. Jaco van As Lv 1 1 pt. 8,023
  3. Avatar for ItzMrCuddles 153. ItzMrCuddles Lv 1 1 pt. 7,948
  4. Avatar for bendbob 154. bendbob Lv 1 1 pt. 7,827
  5. Avatar for mirjamvandelft 155. mirjamvandelft Lv 1 1 pt. 7,584
  6. Avatar for MaxSaddow 156. MaxSaddow Lv 1 1 pt. 7,402
  7. Avatar for Tac1 157. Tac1 Lv 1 1 pt. 7,160
  8. Avatar for 01010011111 158. 01010011111 Lv 1 1 pt. 6,516
  9. Avatar for attylass 159. attylass Lv 1 1 pt. 5,419
  10. Avatar for KingKnut 160. KingKnut Lv 1 1 pt. 5,382

Comments