Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,903
  2. Avatar for freefolder 12. freefolder 1 pt. 8,858
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 8,588
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 8,274
  5. Avatar for Window Group 15. Window Group 1 pt. 5,381
  1. Avatar for Norrjane 41. Norrjane Lv 1 25 pts. 9,292
  2. Avatar for Scopper 42. Scopper Lv 1 24 pts. 9,291
  3. Avatar for tomespen 43. tomespen Lv 1 23 pts. 9,287
  4. Avatar for JayD7217 44. JayD7217 Lv 1 22 pts. 9,285
  5. Avatar for randomlil 45. randomlil Lv 1 21 pts. 9,281
  6. Avatar for YeshuaLives 46. YeshuaLives Lv 1 20 pts. 9,273
  7. Avatar for Glen B 47. Glen B Lv 1 20 pts. 9,270
  8. Avatar for tallguy-13088 48. tallguy-13088 Lv 1 19 pts. 9,269
  9. Avatar for dssb 49. dssb Lv 1 18 pts. 9,266
  10. Avatar for Vredeman 50. Vredeman Lv 1 17 pts. 9,265

Comments